I currently am able to generate a text file with the information but for some reason i can not send the data to go into a list. i have tried it 2 ways:

cnx = mysql.connector.connect(user='root', database='smor')
cursor = cnx.cursor()
sqlQuery = ("SELECT id,name,CAST(aa_seq as CHAR(65535)) aa_seq FROM smor.domain_tbl WHERE domain_type_id=5 AND domain_special IS NULL LIMIT 100000")
cursor.execute(sqlQuery)

print "Generating FASTA file: ", FASTA_File1
with open(FASTA_File1, "w") as FASTA1:
    for (aa_id, name, aa_seq) in cursor:
        FASTA1.write(">" + name + '\n' + aa_seq + '\n')
        print ">" + name + '\n' + aa_seq

ListOfNames =[]
for (aa_id, name, aa_seq) in cursor:
        ListOfNames.append(name)
cursor.close()
print "ListOfNames", ListOfNames

this successfully prints the name and amino acid sequence into the text file but the string is empty. here are the last lines of the output in the console:

>NC_018581.1_05_011_001_020 P
RVPGEMYERAEDGALIPTGVRARWVDAPGSRREIVGPIARHPRIDGRRVDLDVVEEALAAVTGVTAAAVVGLPTDDGVEVGACVVLDRDDLDVPGLRRELSQTLAAHCVPTMISIVESIPLGTDGRPDHGEV
ListOfNames []

As you can see the list remains empty. I thought that perhaps the cursor could not jump back up to the top so i closed the cursor and reopened it exactly as above but with the list generation in the second instance. this caused an error in the script and i do not know why.

Is it that the data can not be read directly into a list?

Theoretically i can split the names of the sequences back out of the text file but i am curious why this method is not working.

share|improve this question
feedback

1 Answer

As you suspect, the cursor's result set can be read once, after which it is 'consumed'.

Just put the result inside the list first, then iterate over the list to write it's content to the file. Or do both in one loop.

share|improve this answer
feedback

Your Answer

 
or
required, but never shown
discard

By posting your answer, you agree to the privacy policy and terms of service.

Not the answer you're looking for? Browse other questions tagged or ask your own question.